PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0044s0480.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 302aa    MW: 33613.3 Da    PI: 7.9945
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0044s0480.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof115.81.8e-3646102561
                  zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                              lkcprC+stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr+++k++
  SapurV1A.0044s0480.1.p  46 LLKCPRCESTNTKFCYYNNYNKSQPRHFCKTCKRHWTKGGTLRNVPVGGGRKNKKQK 102
                             689***********************************************8888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027019.3E-3246101IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.59647101IPR003851Zinc finger, Dof-type
ProDomPD0074789.0E-214895IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104985IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGLSSKQVTG DGLDWSQTLL QAHTLELPRP PVIRRQQEQN QLQFELLKCP RCESTNTKFC  60
YYNNYNKSQP RHFCKTCKRH WTKGGTLRNV PVGGGRKNKK QKTSKTSSNT TNSSSTVSTA  120
APCNNNNMIN RVNPQLAIPA QQQKLNHPDL VHGDQRNFSE TLYQAMINPP SSVLQQNSIS  180
CDNLDTKSFN INNNGVLSGS SVSIPQNQGL LFPYSSYFDT LPSSICTSFQ PSNVYNHTGE  240
SMEDSTITTI MPSTSSSITQ SLQVPNTSSG MDMTNYWNWD DIENFVSADL NVPWDDSEIK  300
P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047842.11e-172PREDICTED: dof zinc finger protein DOF1.1-like
TrEMBLB9HYL31e-168B9HYL3_POPTR; Dof-type zinc finger domain-containing family protein
STRINGPOPTR_0011s04730.11e-168(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.12e-26DOF zinc finger protein 1